Isogambogenic acid

CAS No. 887923-47-9

Isogambogenic acid ( )

Catalog No. M31205 CAS No. 887923-47-9

Isogambogenic acid inhibits angiogenesis and may be a viable drug candidate in anti-angiogenesis therapy.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
50MG Get Quote In Stock
100MG Get Quote In Stock

Biological Information

  • Product Name
    Isogambogenic acid
  • Note
    Research use only, not for human use.
  • Brief Description
    Isogambogenic acid inhibits angiogenesis and may be a viable drug candidate in anti-angiogenesis therapy.
  • Description
    Isogambogenic acid inhibits angiogenesis and may be a viable drug candidate in anti-angiogenesis therapy. Isogambogenic acid exhibits an anticancer effect by inducing autophagy-dependent cell death in NSCLC cells, which may be an effective chemotherapeutic agent that can be used against NSCLC in a clinical setting.
  • Synonyms
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    Bcl-2/Bax | Caspase | mTOR | VEGFR | Akt | MAPK
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    887923-47-9
  • Formula Weight
    630.8
  • Molecular Formula
    C38H46O8
  • Purity
    >98% (HPLC)
  • Solubility
    DMSO, Pyridine, Methanol, Ethanol, etc.
  • SMILES
    ——
  • Chemical Name

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

1.Sci Rep. 2015 Jan 9;5:7697.
molnova catalog
related products
  • Protoescigenin

    Protoescigenin is a natural product.

  • Zinc phthalocyanine

    Zinc phthalocyanine are photosensitiveis commonly applied in industry (catalysts photoconductors) and biomedical (photodynamic therapy).

  • Exendin-4 peptide de...

    GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.